Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida RNA polymerase sigma factor RpoH (rpoH)

This Recombinant Pseudomonas putida RNA polymerase sigma factor RpoH (rpoH) spans the amino acid sequence from region 1-284aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(RNA polymerase sigma-32 factor)

UniProt

Q7CCA6

Expression Region

1-284aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)

Field of Research

Molecular Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTSLQPAYALVPGANLEAYVHTVNSIPLLTVEQERDLGERLYYEQDVEAARQMVMAHLRFVVHIARSYAGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVSFAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNDEVHRVAESLGVEPREVREMESRLSGQDMAFDPAAEADDDSAFQSPAHYLEDHRYDPAVQLEDADWSDNSTSNLHEALQGLDERSRDILYQRWLAEEKATLHELADKYSVSAERIRQLEKNAMNKVKALIAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,4-Dihydro-2H-1,5-benzodioxepine-7-carboxaldehyde
OR23207-01 250 mg

3,4-Dihydro-2H-1,5-benzodioxepine-7-carboxaldehyde

Sign In for Pricing
View Details
3,4-Dihydro-2H-1,5-benzodioxepine-7-carboxaldehyde
OR23207-02 1 g

3,4-Dihydro-2H-1,5-benzodioxepine-7-carboxaldehyde

Sign In for Pricing
View Details
Monkey Olfactory receptor 8B8 (OR8B8) ELISA Kit
GTR10334150 96 Well

Monkey Olfactory receptor 8B8 (OR8B8) ELISA Kit

Sign In for Pricing
View Details
Bovine Glutaminase Liver Isoform, Mitochondrial (GLS2) ELISA Kit
MBS9396714-01 48 Well

Bovine Glutaminase Liver Isoform, Mitochondrial (GLS2) ELISA Kit

Sign In for Pricing
View Details
Bovine Glutaminase Liver Isoform, Mitochondrial (GLS2) ELISA Kit
MBS9396714-02 96 Well

Bovine Glutaminase Liver Isoform, Mitochondrial (GLS2) ELISA Kit

Sign In for Pricing
View Details
Bovine Glutaminase Liver Isoform, Mitochondrial (GLS2) ELISA Kit
MBS9396714-03 5x 96 Well

Bovine Glutaminase Liver Isoform, Mitochondrial (GLS2) ELISA Kit

Sign In for Pricing
View Details