Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus Interleukin-4 (Il4)

This Recombinant Mesocricetus auratus Interleukin-4 (Il4) spans the amino acid sequence from region 25-147aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-4) (B-cell stimulatory factor 1) (Lymphocyte stimulatory factor 1)

UniProt

A0A1U7QAD7

Expression Region

25-147aa

Tag

N-terminal 6xHis-tagged and C-terminal Strep II-tagged

Source

E.coli

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CHHGALKEIIHILNQVTEKGTPCTEMVVPDALSARKNSTEKDLICRASQVLRKFYFQHEVTLCLKNNSRVLKDLKKLYRGISSLFPQKSCNVNESTYTTLKDFLESLRRIMQKKYWQCGSSTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chibby 3 (h) -PR
sc-91954-PR 10 µM - 20 µL

Chibby 3 (h) -PR

Sign In for Pricing
View Details
OR10G7 Antibody
orb671324-01 50 µg

OR10G7 Antibody

Sign In for Pricing
View Details
OR10G7 Antibody
orb671324-02 100 µg

OR10G7 Antibody

Sign In for Pricing
View Details
M/M061/NL539/ALU-297x105-1 Safety & Regulatory Compliance Signs (No Adhesive)
322314 1 Pack (1 Panel (s) x 1 Pack)

M/M061/NL539/ALU-297x105-1 Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
FBXO6 Mouse Monoclonal Antibody [Clone:7A4]
E45M19567 100 µg

FBXO6 Mouse Monoclonal Antibody [Clone:7A4]

Sign In for Pricing
View Details
IRL-2500
sc-204018A 50 mg

IRL-2500

Sign In for Pricing
View Details