Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase (npp)

This Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase (npp) spans the amino acid sequence from region 1-368aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q687E1

Expression Region

1-368aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Hordeum vulgare (Barley)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAVRASPDLLGSRGEDTASDGSVVWAKPYTFRAPPTPGQNSLQRIIVFGDMGKAERDGSNEFANYQPGSLNTTDRLIEDLDNYDIVFHIGDMPYANGYLSQWDQFTAQVAPISAKKPYMVASGNHERDWPNTGGFFDVKDSGGECGVPAETMYYYPAENRANFWYKVDYGMFRFCVGDSEHDWREGTPQYKFIEECLSTVDRKHQPWLIFTAHRVLGYSSNSWYADQGSFEEPEGRESLQKLWQRYRVDIAYFGHVHNYERTCPLYQSQCVNADKTHYSGTMNGTIFVVAGGGGSHLSSYTTAIPKWSIFRDHDYGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTIHRDYRDVLSCVHDSCFPTTLAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tumor Necrosis Factor Ligand Superfamily Member 12 (TWEAK) ELISA Kit
IMSTNFSF12KT 1 Each

Mouse Tumor Necrosis Factor Ligand Superfamily Member 12 (TWEAK) ELISA Kit

Sign In for Pricing
View Details
CBR4 Protein Vector (Human) (pPB-C-His)
PV007637 500 ng

CBR4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)
MBS1207662 Inquire

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Innovative Grade US Origin Fetal Bovine Stomach Frozen  Cleaned
IGFBSTZ 1 Each

Innovative Grade US Origin Fetal Bovine Stomach Frozen Cleaned

Sign In for Pricing
View Details
Urotensin 2 (UST2) BioAssayTM ELISA Kit (Mouse)
153229 96 Tests

Urotensin 2 (UST2) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal WWP2 Antibody [PE]
NBP3-00072PE 0.1 mL

Rabbit Polyclonal WWP2 Antibody [PE]

Sign In for Pricing
View Details