Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell leukemia/lymphoma protein 1A (Tcl1a)

This Recombinant Mouse T-cell leukemia/lymphoma protein 1A (Tcl1a) spans the amino acid sequence from region 1-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Oncogene TCL-1) (Oncogene TCL1) (Protein p14 TCL1)

UniProt

P56280

Expression Region

1-116aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATQRAHRAETPAHPNRLWIWEKHVYLDEFRRSWLPVVIKSNEKFQVILRQEDVTLGEAMSPSQLVPYELPLMWQLYPKDRYRSCDSMYWQILYHIKFRDVEDMLLELIDSESNDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1368 Protein Lysate (Rat) with C-HA Tag
33875036 100 µg

Olr1368 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Ubiquitin Recombinant Antibody, HRP Conjugated
bsm-63008R-HRP-01 20 µL

Ubiquitin Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Ubiquitin Recombinant Antibody, HRP Conjugated
bsm-63008R-HRP-02 100 µL

Ubiquitin Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ITK Antibody [Alexa Fluor 647]
NBP2-32240AF647 0.1 mL

Rabbit Polyclonal ITK Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
TNFRSF14 Antibody
E91969 100 µL

TNFRSF14 Antibody

Sign In for Pricing
View Details
Recombinant Desulfovibrio desulfuricans tRNA modification GTPase MnmE (mnmE)
MBS1455665-01 0.02 mg (E-Coli)

Recombinant Desulfovibrio desulfuricans tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details