Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

This Recombinant Sheep Growth/differentiation factor 9 (GDF9) spans the amino acid sequence from region 319-453aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GDF-9)

UniProt

O77681

Expression Region

319-453aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SMAGP knockout cell line
ABC-KH14264 1 Vial

Human SMAGP knockout cell line

Sign In for Pricing
View Details
Rat ELISA Kit for Daidzein
GTR10369245 96 Well

Rat ELISA Kit for Daidzein

Sign In for Pricing
View Details
Connexin 26, 32, 43 Antibody Array Kit, BioAssayTM
C7853-02 1 Kit

Connexin 26, 32, 43 Antibody Array Kit, BioAssayTM

Sign In for Pricing
View Details
PPM1B Antibody
orb1323337 100 µL

PPM1B Antibody

Sign In for Pricing
View Details
Cela3b 3'UTR GFP Stable Cell Line
TU153700 1.0 mL

Cela3b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal NFkB1/NFkB p105 Antibody [Biotin]
NBP3-05867B 0.1 mL

Rabbit Polyclonal NFkB1/NFkB p105 Antibody [Biotin]

Sign In for Pricing
View Details