Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

This Recombinant Sheep Growth/differentiation factor 9 (GDF9) spans the amino acid sequence from region 319-453aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GDF-9)

UniProt

O77681

Expression Region

319-453aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFAP1 antibody
70R-4332 100 µL

MFAP1 antibody

Sign In for Pricing
View Details
GSK8573
BA4708-10 10 mg

GSK8573

Sign In for Pricing
View Details
Anti-Phospho-PKC zeta/lambda (Thr410/Thr412) Rabbit Monoclonal Antibody
MA4492-.1 100 µL

Anti-Phospho-PKC zeta/lambda (Thr410/Thr412) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GSTA2 siRNA (Mouse)
CRM1712-01 15 nmol

GSTA2 siRNA (Mouse)

Sign In for Pricing
View Details
GSTA2 siRNA (Mouse)
CRM1712-02 30 nmol

GSTA2 siRNA (Mouse)

Sign In for Pricing
View Details
ATP5A1 Antibody
MBS9506063-01 0.05 mL

ATP5A1 Antibody

Sign In for Pricing
View Details