Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collagen alpha-1 (IV) chain (Col4a1), partial

This Recombinant Mouse Collagen alpha-1 (IV) chain (Col4a1), partial spans the amino acid sequence from region 1445-1669aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IV)

UniProt

P02463

Expression Region

1445-1669aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research; Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etoricoxib impurity 17
HY-Z4710-01 5 mg

Etoricoxib impurity 17

Sign In for Pricing
View Details
Etoricoxib impurity 17
HY-Z4710-02 10 mg

Etoricoxib impurity 17

Sign In for Pricing
View Details
Etoricoxib impurity 17
HY-Z4710-03 25 mg

Etoricoxib impurity 17

Sign In for Pricing
View Details
Etoricoxib impurity 17
HY-Z4710-04 50 mg

Etoricoxib impurity 17

Sign In for Pricing
View Details
NPRL2, CT (NPRL2, TUSC4, Nitrogen permease regulator 2-like protein, Gene 21 protein, Tumor suppressor candidate 4) (MaxLight 405) discontinued
039098-ML405 100 µL

NPRL2, CT (NPRL2, TUSC4, Nitrogen permease regulator 2-like protein, Gene 21 protein, Tumor suppressor candidate 4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RAPGEF2 Antibody, FITC conjugated
A72508-100UG 100 µg

RAPGEF2 Antibody, FITC conjugated

Sign In for Pricing
View Details