Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon kappa (IFNK)

This Recombinant Human Interferon kappa (IFNK) spans the amino acid sequence from region 28-207aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFN-kappa)

UniProt

Q9P0W0

Expression Region

28-207aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAIAP3 (NM_003933) Human Recombinant Protein
TP323185L 1 mg

BAIAP3 (NM_003933) Human Recombinant Protein

Sign In for Pricing
View Details
Ccp110 Mouse Gene Knockout Kit (CRISPR)
KN502830 1 Kit

Ccp110 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tensin 1 (TNS1) Human Gene Knockout Kit (CRISPR)
KN424050 1 Kit

Tensin 1 (TNS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACP-105
TRC-A115650-2.5MG 2.5 mg

ACP-105

Sign In for Pricing
View Details
Human CD11b (ITGAM) activation kit by CRISPRa
GA102474 1 Kit

Human CD11b (ITGAM) activation kit by CRISPRa

Sign In for Pricing
View Details
AKT1 pSer473 Rabbit Polyclonal Antibody
AP02353PU-N 100 µL

AKT1 pSer473 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details