Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17)

This Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17) spans the amino acid sequence from region 2-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A5HZZ5

Expression Region

2-146aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Clostridium botulinum

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoacylglycerol Lipase (MGLL) Rabbit Monoclonal Antibody
TA423884 100 µL

Monoacylglycerol Lipase (MGLL) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
AMPD3 (NM_001025390) Human Over-expression Lysate
LC422441 20 µg

AMPD3 (NM_001025390) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Transforming Growth Factor Beta Induced Protein (TGFbI) ELISA Kit
RD-TGFbI-Rb-01 96 Tests

Rabbit Transforming Growth Factor Beta Induced Protein (TGFbI) ELISA Kit

Sign In for Pricing
View Details
Rabbit Transforming Growth Factor Beta Induced Protein (TGFbI) ELISA Kit
RD-TGFbI-Rb-02 48 Tests

Rabbit Transforming Growth Factor Beta Induced Protein (TGFbI) ELISA Kit

Sign In for Pricing
View Details
Cpsf4l Rabbit Polyclonal Antibody
TA375052 100 µL

Cpsf4l Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(3R,5S,6E)-7-(2-Cyclopropyl-4-phenyl-3-quinolinyl)-3,5-dihydroxy-6-heptenoic Acid Sodium Salt
TRC-C988865-25MG 25 mg

(3R,5S,6E)-7-(2-Cyclopropyl-4-phenyl-3-quinolinyl)-3,5-dihydroxy-6-heptenoic Acid Sodium Salt

Sign In for Pricing
View Details