Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Lysozyme C, milk isozyme

This Recombinant Dog Lysozyme C, milk isozyme spans the amino acid sequence from region 1-129aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(1,4-beta-N-acetylmuramidase C)

UniProt

P81708

Expression Region

1-129aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KIFSKCELARKLKSMGMDGFHGYSLANWVCMAEYESNFNTQAFNGRNSNGSSDYGIFQLNSKWWCKSNSHSSANACNIMCSKFLDDNIDDDIACAKRVVKDPNGMSAWVAWVKHCKGKDLSKYLASCNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin3 Mouse Gene Knockout Kit (CRISPR)
KN515532 1 Kit

Septin3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tropomodulin 2 (TMOD2) Rabbit Monoclonal Antibody
TA424180 100 µL

Tropomodulin 2 (TMOD2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805756 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Recombinant CD46 Antibody
RC-6888-01 50 μL

Recombinant CD46 Antibody

Sign In for Pricing
View Details
Recombinant CD46 Antibody
RC-6888-02 100 µL

Recombinant CD46 Antibody

Sign In for Pricing
View Details
Recombinant CD46 Antibody
RC-6888-03 1 mL

Recombinant CD46 Antibody

Sign In for Pricing
View Details