Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tolloid-like protein 1 (Tll1), partial

This Recombinant Mouse Tolloid-like protein 1 (Tll1), partial spans the amino acid sequence from region 148-347aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(mTll)

UniProt

Q62381

Expression Region

148-347aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 Recombinant Chimeric Antibody Antibody
HA601544 100 µL

CD20 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
PAC-1-d8
TRC-P132002-25MG 25 mg

PAC-1-d8

Sign In for Pricing
View Details
Nitenpyram
TRC-N490115-1G 1 g

Nitenpyram

Sign In for Pricing
View Details
APOA5 Human, HEK
OM296964-01 10 µg

APOA5 Human, HEK

Sign In for Pricing
View Details
APOA5 Human, HEK
OM296964-02 2 µg

APOA5 Human, HEK

Sign In for Pricing
View Details
APOA5 Human, HEK
OM296964-03 1 mg

APOA5 Human, HEK

Sign In for Pricing
View Details