Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein S100-B (S100b)

This Recombinant Mouse Protein S100-B (S100b) spans the amino acid sequence from region 2-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)

UniProt

P50114

Expression Region

2-92aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY2C (Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor), GUC2C, STAR) (MaxLight 650)
MBS6227874-01 0.1 mL

GUCY2C (Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor), GUC2C, STAR) (MaxLight 650)

Sign In for Pricing
View Details
GUCY2C (Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor), GUC2C, STAR) (MaxLight 650)
MBS6227874-02 5x 0.1 mL

GUCY2C (Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor), GUC2C, STAR) (MaxLight 650)

Sign In for Pricing
View Details
Human GDF9 Pre-designed siRNA Set B
SI006163B 1 Each

Human GDF9 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR265W (YGR265W) , partial
MBS7061504 Inquire

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR265W (YGR265W) , partial

Sign In for Pricing
View Details
BRCA2 Polyclonal Antibody
MBS8521501-01 0.1 mg

BRCA2 Polyclonal Antibody

Sign In for Pricing
View Details
BRCA2 Polyclonal Antibody
MBS8521501-02 0.1 mL (AF635)

BRCA2 Polyclonal Antibody

Sign In for Pricing
View Details