Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein S100-B (S100b)

This Recombinant Mouse Protein S100-B (S100b) spans the amino acid sequence from region 2-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)

UniProt

P50114

Expression Region

2-92aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-6-chloroiodobenzene
OR400660-01 5 g

2-Bromo-6-chloroiodobenzene

Sign In for Pricing
View Details
2-Bromo-6-chloroiodobenzene
OR400660-02 25 g

2-Bromo-6-chloroiodobenzene

Sign In for Pricing
View Details
ABLIM2 Protein Vector (Mouse) (pPM-C-HA)
PV151424 500 ng

ABLIM2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Itk (2F12) Mouse Monoclonal Antibody (Biotinylated)
CST 84398S 100 µL

Itk (2F12) Mouse Monoclonal Antibody (Biotinylated)

Sign In for Pricing
View Details
Hoagland's No. 2 Basal Salt Mixture With Macronutrients and Micronutrients. Without Nitrogen
HOP03-10LT.1 10 L - 1 Pouch

Hoagland's No. 2 Basal Salt Mixture With Macronutrients and Micronutrients. Without Nitrogen

Sign In for Pricing
View Details
Magic™ Membrane Protein Human MS4A4A (Membrane spanning 4-domains A4A) Full Length
MPC1790K Each

Magic™ Membrane Protein Human MS4A4A (Membrane spanning 4-domains A4A) Full Length

Sign In for Pricing
View Details