Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Infectious bronchitis virus Spike glycoprotein S1 subunit (S1), partial

This Recombinant Infectious bronchitis virus Spike glycoprotein S1 subunit (S1), partial spans the amino acid sequence from region 231-539aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

D9IAI3

Expression Region

231-539aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Infectious bronchitis virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ACQYNTGNFSDGFYPFTNVSLVKERFVVYRETSVNTTLVLTNFTFTNVSNASPNTGGVNTINIYQTQTAQSGYYNFNFSFLSSFVYKQSDFMYGSYHPKCDFRPETINNGLWFNSLSVSLAYGPLQGGCKQSVFSNRATCCYAYSYNGPRLCKGVYIGELPQYFECGLLVYVIKSDGSRIQTRNEPLVLTHYNYNNITLDRCVEYNIYGRSGQGFIINVTASAANYNYLADGGLAILDTSGAIDIFVVQGEYGPNYYKVNPCEDVNQQFVVSGGGIVGVLTSHNETGSQQLENRFYVKLTNSTRRTRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ethanolamine kinase (ETNK1) (N-term) Rabbit Polyclonal Antibody
AP13631PU-N 400 µL

ethanolamine kinase (ETNK1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IL-1RA/IL1RN Protein
PKSH033633-01 10 µg

Recombinant Human IL-1RA/IL1RN Protein

Sign In for Pricing
View Details
Recombinant Human IL-1RA/IL1RN Protein
PKSH033633-02 50 µg

Recombinant Human IL-1RA/IL1RN Protein

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35 + MSA/953), Biotin conjugate, 0.1mg/mL
BNCB1013-500 1x 500 µL

Muscle Specific Actin (HHF35 + MSA/953), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAT1 Antibody
8C10691-AAT 50 µg

MAT1 Antibody

Sign In for Pricing
View Details
Human CUX2 activation kit by CRISPRa
GA108214 1 Kit

Human CUX2 activation kit by CRISPRa

Sign In for Pricing
View Details