Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus Interleukin (Il15)

This Recombinant Mesocricetus auratus Interleukin (Il15) spans the amino acid sequence from region 30-162aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A1U7QZ80

Expression Region

30-162aa

Tag

N-terminal 6xHis-tagged and C-terminal Strep II-tagged

Source

E.coli

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIHVFILGCVSVGLPETEANWKDVISDLKYIESLIQSIHIDATLYTDSDFHPSCKVTAMNCFLLELRVILHEYSNERLNETVRNVIFLANSSLSSNKNITEHGCKECEELEEKDISEFLQSFIRIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB4A protein, Human, Recombinant (His)
E51P90625 20 µg

DEFB4A protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Anti-TPM4 Rabbit pAb
GB115037-100 100 μL

Anti-TPM4 Rabbit pAb

Sign In for Pricing
View Details
ERK2 (MAPK1) Mouse Monoclonal Antibody [Clone ID: OTI6E5]
TA500472S 30 µL

ERK2 (MAPK1) Mouse Monoclonal Antibody [Clone ID: OTI6E5]

Sign In for Pricing
View Details
STAT 5a, b, phosphorylated (Tyr694/699) (Signal Transducer and Activator of Transcription 5a, b) (Biotin) discontinued
S7972-14A-Biotin 100 µL

STAT 5a, b, phosphorylated (Tyr694/699) (Signal Transducer and Activator of Transcription 5a, b) (Biotin) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal HMGN1/HMG14 Antibody
NBP3-03219-100ul 100 µL

Rabbit Polyclonal HMGN1/HMG14 Antibody

Sign In for Pricing
View Details
Recombinant TPX2 Antibody
RC-5953-01 50 μL

Recombinant TPX2 Antibody

Sign In for Pricing
View Details