Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)

This Recombinant Mouse Angiopoietin-related protein 4 (Angptl4) spans the amino acid sequence from region 24-410aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(425O18-1) (Angiopoietin-like protein 4) (Fasting-induced adipose factor) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) (Secreted protein Bk89)

UniProt

Q9Z1P8

Expression Region

24-410aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-500 1x 500 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-100 1x 100 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2580), CF405S conjugate, 0.1mg/mL
BNC042580-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2580), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF488A conjugate, 0.1mg/mL
BNC882156-500 1x 500 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF640R conjugate, 0.1mg/mL
BNC401527-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details