Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3), partial

This Recombinant Human Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3), partial spans the amino acid sequence from region 804-916aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8IX30

Expression Region

804-916aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Procollagen C-endopeptidase enhancer 2 (PCOLCE2) Elisa Kit
EK731442 96 Well

Mouse Procollagen C-endopeptidase enhancer 2 (PCOLCE2) Elisa Kit

Sign In for Pricing
View Details
Ube2v2 ORF Vector (Rat) (pORF)
ORF078535 1.0 µg DNA

Ube2v2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
BAF60a Polyclonal Conjugated Antibody
orb1625395 100 µL

BAF60a Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype A2 subtype adw External core antigen (C)
MBS1259519-01 0.02 mg (E-Coli)

Recombinant Hepatitis B virus genotype A2 subtype adw External core antigen (C)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype A2 subtype adw External core antigen (C)
MBS1259519-02 0.1 mg (E-Coli)

Recombinant Hepatitis B virus genotype A2 subtype adw External core antigen (C)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype A2 subtype adw External core antigen (C)
MBS1259519-03 0.02 mg (Yeast)

Recombinant Hepatitis B virus genotype A2 subtype adw External core antigen (C)

Sign In for Pricing
View Details