Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2), partial

This Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2), partial spans the amino acid sequence from region 68-473aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P03107

Expression Region

68-473aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Human papillomavirus type 16

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDPAFVTTPTKLITYDNPAYEGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTGIRYSRIGNKQTLRTRSGKSIGAKVHYYYDLSTIDPAEEIELQTITPSTYTTTSHAASPTSINNGLYDIYADDFITDTSTTPVPSVPSTSLSGYIPANTTIPFGGAYNIPLVSGPDIPINITDQAPSLIPIVPGSPQYTIIADAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit
KTE62400-01 48 Tests

Human Epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit

Sign In for Pricing
View Details
Human Epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit
KTE62400-02 96 Tests

Human Epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit

Sign In for Pricing
View Details
Human Epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit
KTE62400-03 5x 96 Tests

Human Epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit

Sign In for Pricing
View Details
Human Epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit
KTE62400-04 50x 96 Tests

Human Epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit

Sign In for Pricing
View Details
Human ApoD Antibody Pair Set
E-KAB-0506 50 µL & 100 µg

Human ApoD Antibody Pair Set

Sign In for Pricing
View Details
SRSP1 shRNA (m) Lentiviral Particles
sc-153833-V 200 µL

SRSP1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details