Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon kappa (IFNK)

This Recombinant Human Interferon kappa (IFNK) spans the amino acid sequence from region 28-207aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFN-kappa)

UniProt

Q9P0W0

Expression Region

28-207aa

Tag

C-terminal 6xHis-PDI-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

80.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse HSP60 ELISA Kit (Colorimetric)
NBP2-76443 1 Kit

Mouse HSP60 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial (8D4.130, NCU01227), partial
MBS1308330 Inquire

Recombinant Neurospora crassa Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial (8D4.130, NCU01227), partial

Sign In for Pricing
View Details
QPRT Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV695549 1.0 µg DNA

QPRT Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Gm9268 (NM_001105061) Mouse Tagged ORF Clone Lentiviral Particle
MR214043L4V 200 µL

Gm9268 (NM_001105061) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
IDO1 Protein, Human, Recombinant
TMPY-02928-01 5 µg

IDO1 Protein, Human, Recombinant

Sign In for Pricing
View Details
IDO1 Protein, Human, Recombinant
TMPY-02928-02 10 µg

IDO1 Protein, Human, Recombinant

Sign In for Pricing
View Details