Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

This Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) spans the amino acid sequence from region 20-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6MG58

Expression Region

20-108aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/mL can bind Anti-Ly6g6d recombinant antibody. The EC50 is 6.238-7.258 ng/mL.

Form

Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rac1 shRNA (UAS) - Lentiviral mouse Rac1 shRNA (UAS) plasmid
GTR15218227 1 Vial

Lentiviral mouse Rac1 shRNA (UAS) - Lentiviral mouse Rac1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human IL-1R4/ST2 ELISA Kit
RK00377 96 Tests

Human IL-1R4/ST2 ELISA Kit

Sign In for Pricing
View Details
(Rac) -Hydnocarpin
HY-N7199-01 5 mg

(Rac) -Hydnocarpin

Sign In for Pricing
View Details
(Rac) -Hydnocarpin
HY-N7199-02 10 mg

(Rac) -Hydnocarpin

Sign In for Pricing
View Details
(Rac) -Hydnocarpin
HY-N7199-03 25 mg

(Rac) -Hydnocarpin

Sign In for Pricing
View Details
Goat Spastin (SPAST) ELISA kit
GTR10408649 96 Well

Goat Spastin (SPAST) ELISA kit

Sign In for Pricing
View Details