Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

This Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial (Active) spans the amino acid sequence from region 19-135aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor; Gipr

UniProt

P43219

Expression Region

19-135aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Gastroenterology & Hepatology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2 μg/mL can bind Anti-Mouse Gipr recombinant antibody, the EC50 is 6.946-8.740 ng/ml.

Form

Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DSG3 Recombinant Protein
PPT-12356 100 µg

Human DSG3 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Cytochrome P450 1A2 Antibody (D15) [DyLight 405]
NB600-1490V 0.1 mL

Mouse Monoclonal Cytochrome P450 1A2 Antibody (D15) [DyLight 405]

Sign In for Pricing
View Details
Human Tumor protein p53-inducible nuclear protein 1 (TP53INP1) ELISA Kit
EK6043 48 Tests

Human Tumor protein p53-inducible nuclear protein 1 (TP53INP1) ELISA Kit

Sign In for Pricing
View Details
P38 MAPK/ MAPK14 Polyclonal Antibody, Cy5.5 Conjugated
bs-28027R-Cy5.5 100 µL

P38 MAPK/ MAPK14 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
CA50, Cancer Antigen (Colorectal Carcinoma Cell Line, COLO-205) (MaxLight 550) discontinued
137596-ML550 100 µL

CA50, Cancer Antigen (Colorectal Carcinoma Cell Line, COLO-205) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mouse CDH13 Recombinant Protein
PPT-16444 100 µg

Mouse CDH13 Recombinant Protein

Sign In for Pricing
View Details