Recombinant Human Single Ig IL-1-related receptor (SIGIRR), partial
This Recombinant Human Single Ig IL-1-related receptor (SIGIRR), partial spans the amino acid sequence from region 1-118aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Single Ig IL-1R-related molecule; Single immunoglobulin domain-containing IL1R-related protein; Toll/interleukin-1 receptor 8 (TIR8)
UniProt
Q6IA17
Expression Region
1-118aa
Tag
C-terminal 6xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
14.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal FCAR/CD89 Antibody (488032) [Janelia Fluor 646]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
FAB3939J 0.1 mL
Mouse Monoclonal FCAR/CD89 Antibody (488032) [Janelia Fluor 646]
Sign In for Pricing
View Details 
GTR15097904 1 Vial
Lentiviral human PFN2 shRNA (UAS) - Lentiviral human PFN2 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details sc-434068-LAC 200 µL
ζ-Sarcoglycan Lentiviral Activation Particles (m)
Sign In for Pricing
View Details