Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Aldehyde dehydrogenase 1A1 (Aldh1a1)

This Recombinant Mouse Aldehyde dehydrogenase 1A1 (Aldh1a1) spans the amino acid sequence from region 2-501aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

3-deoxyglucosone dehydrogenase; ALDH-E1; ALHDII; Aldehyde dehydrogenase family 1 member A1; Aldehyde dehydrogenase, cytosolic; Retinal dehydrogenase 1; RALDH 1; RalDH1

UniProt

P24549

Expression Region

2-501aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC6B (NM_015189) Human Tagged Lenti ORF Clone
RC224563L4 10 µg

EXOC6B (NM_015189) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TSHR Recombinant Monoclonal Antibody
RAC08099-01 50 µL

TSHR Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
TSHR Recombinant Monoclonal Antibody
RAC08099-02 100 µL

TSHR Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Cat Caveolin 1 ELISA Kit
MBS094993 Inquire

Cat Caveolin 1 ELISA Kit

Sign In for Pricing
View Details
Human NCALD Protein
E40KMPH6546 20 µg

Human NCALD Protein

Sign In for Pricing
View Details
OMD Antibody - C-terminal region
MBS3220345-01 0.1 mL

OMD Antibody - C-terminal region

Sign In for Pricing
View Details