Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Flotillin-2 (FLOT2)

This Recombinant Human Flotillin-2 (FLOT2) spans the amino acid sequence from region 2-428aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epidermal surface antigen; ESA; Membrane component chromosome 17 surface marker 1

UniProt

Q14254

Expression Region

2-428aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ragulator complex protein LAMTOR2, LAMTOR2 ELISA KIT
ELI-22732h 96 Tests

Human Ragulator complex protein LAMTOR2, LAMTOR2 ELISA KIT

Sign In for Pricing
View Details
Mouse Prostaglandin-H2 D-isomerase (PTGDS) ELISA Kit
abx254342-01 96 Tests

Mouse Prostaglandin-H2 D-isomerase (PTGDS) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostaglandin-H2 D-isomerase (PTGDS) ELISA Kit
abx254342-02 5x 96 Tests

Mouse Prostaglandin-H2 D-isomerase (PTGDS) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostaglandin-H2 D-isomerase (PTGDS) ELISA Kit
abx254342-03 10x 96 Tests

Mouse Prostaglandin-H2 D-isomerase (PTGDS) ELISA Kit

Sign In for Pricing
View Details
Mitochondrial Uncoupling Protein 2 (UCP2) Polyclonal Antibody
CAU24087-01 100 µL

Mitochondrial Uncoupling Protein 2 (UCP2) Polyclonal Antibody

Sign In for Pricing
View Details
Mitochondrial Uncoupling Protein 2 (UCP2) Polyclonal Antibody
CAU24087-02 200 µL

Mitochondrial Uncoupling Protein 2 (UCP2) Polyclonal Antibody

Sign In for Pricing
View Details