Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gastric inhibitory polypeptide (GIP)

This Recombinant Human Gastric inhibitory polypeptide (GIP) spans the amino acid sequence from region 52-93aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GIP; Glucose-dependent insulinotropic polypeptide; Incretin hormone

UniProt

P09681

Expression Region

52-93aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF-1 / NKX2.1 (8G7G3/1), CF647 conjugate, 0.1mg/mL
BNC470448-500 1x 500 µL

TTF-1 / NKX2.1 (8G7G3/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
USP45 Human Gene Knockout Kit (CRISPR)
KN417920 1 Kit

USP45 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), Biotin conjugate, 0.1mg/mL
BNCB1718-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASPA Recombinant Chimeric Antibody Antibody
HA610269 100 µg

ASPA Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Human Knockdown Lysate
LY300092 100 µg

Cyclin D1 (CCND1) Human Knockdown Lysate

Sign In for Pricing
View Details
Smarca2 Mouse Gene Knockout Kit (CRISPR)
KN516282 1 Kit

Smarca2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details