Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gastric inhibitory polypeptide (GIP)

This Recombinant Human Gastric inhibitory polypeptide (GIP) spans the amino acid sequence from region 52-93aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GIP; Glucose-dependent insulinotropic polypeptide; Incretin hormone

UniProt

P09681

Expression Region

52-93aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human MPO (Myeloperoxidase) ELISA Kit
E-UNEL-H0048-01 5x 96 Tests

Uncoated Human MPO (Myeloperoxidase) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human MPO (Myeloperoxidase) ELISA Kit
E-UNEL-H0048-02 15x 96 Tests

Uncoated Human MPO (Myeloperoxidase) ELISA Kit

Sign In for Pricing
View Details
Eph receptor B2 (EPHB2) (N-term) Rabbit Polyclonal Antibody
AP14296PU-N 400 µL

Eph receptor B2 (EPHB2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HGS (NM_004712) Human Over-expression Lysate
LY401488 100 µg

HGS (NM_004712) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SESN1 activation kit by CRISPRa
GA109080 1 Kit

Human SESN1 activation kit by CRISPRa

Sign In for Pricing
View Details
1,2-Bis(tosyloxy)ethane
TRC-B419350-500MG 500 mg

1,2-Bis(tosyloxy)ethane

Sign In for Pricing
View Details