Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epididymal-specific lipocalin-10 (Lcn10), partial

This Recombinant Mouse Epididymal-specific lipocalin-10 (Lcn10), partial spans the amino acid sequence from region 20-135aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q810Z1

Expression Region

20-135aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEFFPKEAQTLNWSKFSGFWYIIAIATDTQGFLPARDKRKLGASVVKVHKTGQLRVVIAFSRPRGCQSREVTLKKDRKRPVFRNTLKGVKGFHVLSTDYTYGLVYLRLGRGGSNYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (MaxLight 550)
244976-ML550 100 µL

CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-BAD (Y110) Antibody
orb1931016-01 50 µL

Phospho-BAD (Y110) Antibody

Sign In for Pricing
View Details
Phospho-BAD (Y110) Antibody
orb1931016-02 100 µL

Phospho-BAD (Y110) Antibody

Sign In for Pricing
View Details
PPAR Gamma Polyclonal Antibody, Cy3 Conjugated
bs-4590R-Cy3-TR 20 µL

PPAR Gamma Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Human CRYGS Protein, N-His
HA610012-01 50 µg

Recombinant Human CRYGS Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CRYGS Protein, N-His
HA610012-02 100 µg

Recombinant Human CRYGS Protein, N-His

Sign In for Pricing
View Details