Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oreochromis niloticus Leptin B (LepB)

This Recombinant Oreochromis niloticus Leptin B (LepB) spans the amino acid sequence from region 18-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A067Z7V9

Expression Region

18-152aa

Tag

Tag-Free

Source

E.coli

Origin

Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STILLTKGESIKNTIHNIVNIAQITLVHIKKLKLPATPTEVPTPSIDGLSSISHDLGVLDNELQHPFLIQIQADVSSLEGRVRSFALSMECPLKPKPAVQTDESVFPDSRLYMTVAKVQHYLEKLILNKGKLKLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta C chain (INHBC) (NM_005538) Human Recombinant Protein
TP311922L 1 mg

Inhibin beta C chain (INHBC) (NM_005538) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human PABPC4 Protein
E30P5022 20 µg

Recombinant Human PABPC4 Protein

Sign In for Pricing
View Details
6-Methylnonanoyl-CoA
TYD-03532-01 10 mg

6-Methylnonanoyl-CoA

Sign In for Pricing
View Details
6-Methylnonanoyl-CoA
TYD-03532-02 50 mg

6-Methylnonanoyl-CoA

Sign In for Pricing
View Details
ACPT Polyclonal Antibody, PerCP Conjugated
bs-6289R-PerCP 100 µL

ACPT Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Goat Sulfite oxidase, mitochondrial (SUOX) ELISA Kit
GTR10312872 96 Well

Goat Sulfite oxidase, mitochondrial (SUOX) ELISA Kit

Sign In for Pricing
View Details