Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Cell surface-binding protein OPG105 (D8L), partial

This Recombinant Vaccinia virus IMV membrane protein (D8L), partial spans the amino acid sequence from region 1-261aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carbonic anhydrase homolog

UniProt

L7QJR5

Expression Region

1-261aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLRIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPARDNYFMRWLSDLRET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Enah/Vasp Like Protein (EVL) ELISA Kit
TRV-0006072 96 Well Plate

Human Enah/Vasp Like Protein (EVL) ELISA Kit

Sign In for Pricing
View Details
OlfmL1 Rat shRNA Plasmid (Locus ID 361621)
TL701933 1 Kit

OlfmL1 Rat shRNA Plasmid (Locus ID 361621)

Sign In for Pricing
View Details
Mouse Tsta3 / GDP-L-fucose synthase Recombinant Protein
R15169m 1 Each

Mouse Tsta3 / GDP-L-fucose synthase Recombinant Protein

Sign In for Pricing
View Details
Advillin (AVIL), Recombinant, Rat, His-Tag
050737-01 10 µg

Advillin (AVIL), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Advillin (AVIL), Recombinant, Rat, His-Tag
050737-02 50 µg

Advillin (AVIL), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Advillin (AVIL), Recombinant, Rat, His-Tag
050737-03 100 µg

Advillin (AVIL), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details