Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial, Biotinylated

This Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial, Biotinylated spans the amino acid sequence from region 763-931aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor I receptor; IGF-I receptor; CD antigen CD221

UniProt

P08069

Expression Region

763-931aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ras-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1) Antibody
abx375176 100 µg

Ras-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1) Antibody

Sign In for Pricing
View Details
WWP1 Protein Vector (Human) (pPM-C-His)
PV046496 500 ng

WWP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
3- (4-Fluorobenzyloxy) -bromobenzene
sc-322264A 25 g

3- (4-Fluorobenzyloxy) -bromobenzene

Sign In for Pricing
View Details
CHCHD3 (Coiled-coil-Helix-Coiled-coil-Helix Domain-Containing Protein 3, Mitochondrial, Coiled-coil-Helix-Coiled-coil-Helix Domain-Containing 3)
477909 100 µL

CHCHD3 (Coiled-coil-Helix-Coiled-coil-Helix Domain-Containing Protein 3, Mitochondrial, Coiled-coil-Helix-Coiled-coil-Helix Domain-Containing 3)

Sign In for Pricing
View Details
RNF105 Rabbit pAb, PE-Cy7 conjugated
orb2827551 100 µL

RNF105 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Ethyl trans-α-cyanocinnamate
sc-228081 5 g

Ethyl trans-α-cyanocinnamate

Sign In for Pricing
View Details