Recombinant Dog Lutropin subunit beta (LHB), Biotinylated
This Recombinant Dog Lutropin subunit beta (LHB), Biotinylated spans the amino acid sequence from region 18-138aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Luteinizing hormone subunit beta; LH-B; LSH-B; LSH-beta; Lutropin beta chain
UniProt
P18842
Expression Region
18-138aa
Tag
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Source
E.coli
Origin
Canis lupus familiaris (Dog) (Canis familiaris)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
60.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680525-100 1x 100 µL
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471866-500 1x 500 µL
Calponin-1 (Smooth Muscle Marker) (rCNN1/832), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details