Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD109 antigen (Cd109), partial

This Recombinant Mouse CD109 antigen (Cd109), partial spans the amino acid sequence from region 595-704aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GPI-anchored alpha-2 macroglobulin-related protein; CD antigen CD109

UniProt

Q8R422

Expression Region

595-704aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKSVTLMENSNSITMETMVHELELYNTEYYLGMFMNSFAVFQECGLWVLTDATLIRDSIDEVYDTEEYSERFAEENEANLVDFEDASSVNNVHVRKNFPETWIWLDAYMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISL2 antibody
MBS833762-01 0.1 mL

ISL2 antibody

Sign In for Pricing
View Details
ISL2 antibody
MBS833762-02 5x 0.1 mL

ISL2 antibody

Sign In for Pricing
View Details
(S) -Amisulpride
M27838-01 1 g

(S) -Amisulpride

Sign In for Pricing
View Details
(S) -Amisulpride
M27838-02 500 mg

(S) -Amisulpride

Sign In for Pricing
View Details
(S) -Amisulpride
M27838-03 5 mg

(S) -Amisulpride

Sign In for Pricing
View Details
(S) -Amisulpride
M27838-04 10 mg

(S) -Amisulpride

Sign In for Pricing
View Details