Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD109 antigen (Cd109), partial

This Recombinant Mouse CD109 antigen (Cd109), partial spans the amino acid sequence from region 595-704aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GPI-anchored alpha-2 macroglobulin-related protein; CD antigen CD109

UniProt

Q8R422

Expression Region

595-704aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKSVTLMENSNSITMETMVHELELYNTEYYLGMFMNSFAVFQECGLWVLTDATLIRDSIDEVYDTEEYSERFAEENEANLVDFEDASSVNNVHVRKNFPETWIWLDAYMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL6 Mouse Monoclonal Antibody [Clone ID: LBI6D3]
AMM21283V 100 µL

IL6 Mouse Monoclonal Antibody [Clone ID: LBI6D3]

Sign In for Pricing
View Details
NPBW2 Polyclonal Antibody
UB-GEN-7236 100 µL

NPBW2 Polyclonal Antibody

Sign In for Pricing
View Details
2-Methyl-2- (propan-2-yl) cyclopropan-1-amine hydrochloride
JBD34802-01 50 mg

2-Methyl-2- (propan-2-yl) cyclopropan-1-amine hydrochloride

Sign In for Pricing
View Details
2-Methyl-2- (propan-2-yl) cyclopropan-1-amine hydrochloride
JBD34802-02 0.5 g

2-Methyl-2- (propan-2-yl) cyclopropan-1-amine hydrochloride

Sign In for Pricing
View Details
In vivo Grade Recombinant MOPC-21 Mouse IgG2c Isotype Control, In Vivo Grade Recombinant Mouse
587260 1 mg

In vivo Grade Recombinant MOPC-21 Mouse IgG2c Isotype Control, In Vivo Grade Recombinant Mouse

Sign In for Pricing
View Details
Olfactory Receptor 10C1 Polyclonal Antibody
BT-AP12196-01 20 µL

Olfactory Receptor 10C1 Polyclonal Antibody

Sign In for Pricing
View Details