Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRCA1-associated protein (BRAP), partial

This Recombinant Human BRCA1-associated protein (BRAP), partial spans the amino acid sequence from region 294-346aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

J3KNN7

Expression Region

294-346aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor XIIIa polyclonal antibody
orb1725091-01 50 µL

Factor XIIIa polyclonal antibody

Sign In for Pricing
View Details
Factor XIIIa polyclonal antibody
orb1725091-02 100 µL

Factor XIIIa polyclonal antibody

Sign In for Pricing
View Details
CARD8 (Caspase Recruitment Domain-containing Protein 8, Apoptotic Protein NDPP1, CARD-inhibitor of NF-kappa-B-activating Ligand, CARDINAL, DACAR, DAKAR, DKFZp779L0366, FLJ18119, FLJ18121, KIAA0955, MGC57162, NDPP1, NDPP, Tumor Up-regulated CARD-containing Antagonist of CASP9, TUCAN) (Not for Export EU)
C1349-05G 50 µL

CARD8 (Caspase Recruitment Domain-containing Protein 8, Apoptotic Protein NDPP1, CARD-inhibitor of NF-kappa-B-activating Ligand, CARDINAL, DACAR, DAKAR, DKFZp779L0366, FLJ18119, FLJ18121, KIAA0955, MGC57162, NDPP1, NDPP, Tumor Up-regulated CARD-containing Antagonist of CASP9, TUCAN) (Not for Export EU)

Sign In for Pricing
View Details
ERBB3 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (avian), ErbB-3, HER3, LCCS2, MDA-BF-1, MGC88033, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3) (PE)
245813-PE 100 µL

ERBB3 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (avian), ErbB-3, HER3, LCCS2, MDA-BF-1, MGC88033, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3) (PE)

Sign In for Pricing
View Details
Recombinant Mouse Dynein assembly factor 1, axonemal (Dnaaf1)
MBS1309799-01 0.02 mg (E-Coli)

Recombinant Mouse Dynein assembly factor 1, axonemal (Dnaaf1)

Sign In for Pricing
View Details
Recombinant Mouse Dynein assembly factor 1, axonemal (Dnaaf1)
MBS1309799-02 0.02 mg (Yeast)

Recombinant Mouse Dynein assembly factor 1, axonemal (Dnaaf1)

Sign In for Pricing
View Details