Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRCA1-associated protein (BRAP), partial

This Recombinant Human BRCA1-associated protein (BRAP), partial spans the amino acid sequence from region 294-346aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

J3KNN7

Expression Region

294-346aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rhpn2 shRNA (UAS) - Lentiviral mouse Rhpn2 shRNA (UAS) (25)
GTR15297740 1 Vial

Lentiviral mouse Rhpn2 shRNA (UAS) - Lentiviral mouse Rhpn2 shRNA (UAS) (25)

Sign In for Pricing
View Details
OsMPK6 Rabbit pAb
orb2706297-01 50 µL

OsMPK6 Rabbit pAb

Sign In for Pricing
View Details
OsMPK6 Rabbit pAb
orb2706297-02 100 µL

OsMPK6 Rabbit pAb

Sign In for Pricing
View Details
PRMT3 Antibody (C-term)
orb1939187-01 50 µL

PRMT3 Antibody (C-term)

Sign In for Pricing
View Details
PRMT3 Antibody (C-term)
orb1939187-02 100 µL

PRMT3 Antibody (C-term)

Sign In for Pricing
View Details
Recombinant Human GCK (N-GST tag)
Z500152 10 µg

Recombinant Human GCK (N-GST tag)

Sign In for Pricing
View Details