Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus interleukin-27 subunit alpha

This Recombinant Mesocricetus auratus interleukin-27 subunit alpha spans the amino acid sequence from region 85-296aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Expression Region

85-296aa

Tag

N-terminal 6xHis-tagged and C-terminal Strep II-tagged

Source

E.coli

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPTGPLSLQELRREFTASLYLARKLLSEAQSYVHSFAESRLPGVSLDLLPLGHHLPNVSLTFQAWHHLSDPERLCFLSTTLRPLPALLGGLGSQGTWTSSERVQLWAMRLDLRDLHRHLRFQVLAARFNCSEEEEEEEEEEKEGKGLFLGALDGPKQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLTMPRHPDPALGSQHLTSSPVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1468), CF740 conjugate, 0.1mg/mL
BNC741468-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1468), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (IVRN/827), CF568 conjugate, 0.1mg/mL
BNC680827-500 1x 500 µL

Involucrin (IVRN/827), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF647 conjugate, 0.1mg/mL
BNC472151-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details