Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor B (VEGFB), partial

This Recombinant Human Vascular endothelial growth factor B (VEGFB), partial spans the amino acid sequence from region 31-129aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VEGF-B; VEGF-related factor; VRF

UniProt

P49765

Expression Region

31-129aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jurkat Cytosolic Extract, Uninduced discontinued
J9000-10-01 400 µg

Jurkat Cytosolic Extract, Uninduced discontinued

Sign In for Pricing
View Details
Jurkat Cytosolic Extract, Uninduced discontinued
J9000-10-02 1 mg

Jurkat Cytosolic Extract, Uninduced discontinued

Sign In for Pricing
View Details
Mouse IL-1ra (Interleukin 1 Receptor Antagonist) ELISA Kit
MBS2502932-01 24 Tests (Limit 1)

Mouse IL-1ra (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-1ra (Interleukin 1 Receptor Antagonist) ELISA Kit
MBS2502932-02 48 Tests

Mouse IL-1ra (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-1ra (Interleukin 1 Receptor Antagonist) ELISA Kit
MBS2502932-03 96 Tests

Mouse IL-1ra (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-1ra (Interleukin 1 Receptor Antagonist) ELISA Kit
MBS2502932-04 5x 96 Tests

Mouse IL-1ra (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details