Recombinant Human Delta-like protein 3 (DLL3), partial (Active)
This Recombinant Human Delta-like protein 3 (DLL3), partial (Active) spans the amino acid sequence from region 391-492aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)
UniProt
Q9NYJ7
Expression Region
391-492aa
Tag
C-terminal mFc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/mL can bind Anti-DLL3 recombinant antibody. The EC50 is 6.080-7.240 ng/mL.
Form
Lyophilized powder
Molecular Weight
39.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1167-100 1x 100 µL
Cytokeratin 7 (KRT7/760 + OV-TL12/30), 0.2mg/mL
Sign In for Pricing
View Details