Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Gap junction alpha-1 protein (GJA1)

This Recombinant Bovine Gap junction alpha-1 protein (GJA1) spans the amino acid sequence from region 2-383aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) ; Vascular smooth muscle connexin-43

UniProt

P18246

Expression Region

2-383aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVVAQTDGANVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGKSDPYHTTTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDHQNSKKLDAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Olfactory receptor 10Z1 (OR10Z1) ELISA kit
GTR10375926 96 Well

Sheep Olfactory receptor 10Z1 (OR10Z1) ELISA kit

Sign In for Pricing
View Details
Hexokinase (HXK) (Biotin) discontinued
H2035-04B 1 mL

Hexokinase (HXK) (Biotin) discontinued

Sign In for Pricing
View Details
FAM78B Rabbit Polyclonal Antibody (HRP)
orb2110256 100 µL

FAM78B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
NSD3 Rabbit Polyclonal Antibody (Fluoro488)
orb3091760 100 µg

NSD3 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Collagen Type IV (COL IV) Rabbit ELISA Kit
C5219 96 Tests

Collagen Type IV (COL IV) Rabbit ELISA Kit

Sign In for Pricing
View Details
RRH Peptide - N-terminal region
MBS3246980-01 0.1 mg

RRH Peptide - N-terminal region

Sign In for Pricing
View Details