Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus B5R (B5R)

This Recombinant Vaccinia virus B5R (B5R) spans the amino acid sequence from region 1-317aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q80KX4

Expression Region

1-317aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Vaccinia virus

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRSNKEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB8 Mouse Monoclonal Antibody [Clone ID: 1A5]
AM06666SU-N 100 µL

PSMB8 Mouse Monoclonal Antibody [Clone ID: 1A5]

Sign In for Pricing
View Details
CARD6 Polyclonal Antibody
E-AB-90680-01 60 µL

CARD6 Polyclonal Antibody

Sign In for Pricing
View Details
CARD6 Polyclonal Antibody
E-AB-90680-02 120 µL

CARD6 Polyclonal Antibody

Sign In for Pricing
View Details
CARD6 Polyclonal Antibody
E-AB-90680-03 200 µL

CARD6 Polyclonal Antibody

Sign In for Pricing
View Details
SRP54 (NM_001146282) Human Over-expression Lysate
LY431398 100 µg

SRP54 (NM_001146282) Human Over-expression Lysate

Sign In for Pricing
View Details
GLUT9 (SLC2A9) Human Gene Knockout Kit (CRISPR)
KN402647 1 Kit

GLUT9 (SLC2A9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details