Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Claudin-5 (Cldn5)

This Recombinant Rat Claudin-5 (Cldn5) spans the amino acid sequence from region 1-218aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9JKD6

Expression Region

1-218aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A13 Double Nickase Plasmid (h)
sc-418228-NIC 20 µg

MS4A13 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)
MBS1448413-01 0.02 mg (E-Coli)

Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)

Sign In for Pricing
View Details
Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)
MBS1448413-02 0.1 mg (E-Coli)

Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)

Sign In for Pricing
View Details
Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)
MBS1448413-03 0.02 mg (Yeast)

Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)

Sign In for Pricing
View Details
Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)
MBS1448413-04 0.1 mg (Yeast)

Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)

Sign In for Pricing
View Details
Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)
MBS1448413-05 0.02 mg (Baculovirus)

Recombinant Ursus thibetanus Brain-derived neurotrophic factor (BDNF)

Sign In for Pricing
View Details