Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (SRD5A1)

This Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (SRD5A1) spans the amino acid sequence from region 1-259aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SR type 1; Steroid 5-alpha-reductase 1; S5AR 1

UniProt

P18405

Expression Region

1-259aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIP1 Rabbit Polyclonal Antibody (APC)
orb1008918 100 µL

SIP1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
IL3RB (CSF2RB) Mouse Monoclonal Antibody [Clone ID: LBI2G6]
AMM18052VCF 100 µg

IL3RB (CSF2RB) Mouse Monoclonal Antibody [Clone ID: LBI2G6]

Sign In for Pricing
View Details
Bovine Secreted Frizzled Related Protein 5 ELISA Kit
OM618031 96 Strip Well

Bovine Secreted Frizzled Related Protein 5 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human NCAPH Protein
E30P63613A 50 µg

Recombinant Human NCAPH Protein

Sign In for Pricing
View Details
Anti-Human IgG
DB-174-0.5 500 μl

Anti-Human IgG

Sign In for Pricing
View Details
Trimethylsilyl Difluoro (fluorosulfonyl) acetate
291619-01 5 g

Trimethylsilyl Difluoro (fluorosulfonyl) acetate

Sign In for Pricing
View Details