Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human STEAP1 protein (STEAP1)

This Recombinant Human Metalloreductase STEAP1 (STEAP1) spans the amino acid sequence from region 1-339aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Six-transmembrane epithelial antigen of prostate 1

UniProt

Q9UHE8

Expression Region

1-339aa

Tag

C-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntenin (SDCBP) (NM_005625) Human Tagged ORF Clone Lentiviral Particle
RC215390L1V 200 µL

Syntenin (SDCBP) (NM_005625) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Human TRIM44 Polyclonal Antibody
PHK39501 100 μg

Anti-Human TRIM44 Polyclonal Antibody

Sign In for Pricing
View Details
CVA6 VP2/Capsid VP2 Protein (N-His, Coxsackievirus A6)
P502989 100 µg

CVA6 VP2/Capsid VP2 Protein (N-His, Coxsackievirus A6)

Sign In for Pricing
View Details
Rat Elastase 2A (ELA2A) ELISA Kit
QY-E10333 96 Tests

Rat Elastase 2A (ELA2A) ELISA Kit

Sign In for Pricing
View Details
Mouse Heart Fatty Acid Binding Protein HFABP ELISA Kit
BG-MUS11230 1 Each

Mouse Heart Fatty Acid Binding Protein HFABP ELISA Kit

Sign In for Pricing
View Details
1-Iodoperfluoroalkanes, C12-C16
sc-351957 5 g

1-Iodoperfluoroalkanes, C12-C16

Sign In for Pricing
View Details