Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human STEAP1 protein (STEAP1)

This Recombinant Human Metalloreductase STEAP1 (STEAP1) spans the amino acid sequence from region 1-339aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Six-transmembrane epithelial antigen of prostate 1

UniProt

Q9UHE8

Expression Region

1-339aa

Tag

C-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI2D5]
TA502691S 30 µL

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI2D5]

Sign In for Pricing
View Details
Loratadine
MBS3605985-01 500 mg

Loratadine

Sign In for Pricing
View Details
Loratadine
MBS3605985-02 5x 500 mg

Loratadine

Sign In for Pricing
View Details
MC1 Receptor Rabbit pAb
E45R19749N-50 50 µL

MC1 Receptor Rabbit pAb

Sign In for Pricing
View Details
KIAA1826 Over-expression Lysate Product
GWB-31C70F 0.1 mg

KIAA1826 Over-expression Lysate Product

Sign In for Pricing
View Details
MAYV Spike glyco E1 Protein (N-His, Mayaro virus (MAYV) )
P505881 100 µg

MAYV Spike glyco E1 Protein (N-His, Mayaro virus (MAYV) )

Sign In for Pricing
View Details