Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse STEAP1 protein (Steap1)

This Recombinant Mouse STEAP1 protein (Steap1) spans the amino acid sequence from region 1-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Six-transmembrane epithelial antigen of prostate 1

UniProt

Q9CWR7

Expression Region

1-339aa

Tag

C-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Chd8 shRNA (UAS) - Lentiviral mouse Chd8 shRNA (UAS) (100)
GTR15173778 1 Vial

Lentiviral mouse Chd8 shRNA (UAS) - Lentiviral mouse Chd8 shRNA (UAS) (100)

Sign In for Pricing
View Details
Anti-ALDH1A1 Polyclonal Antibody
PHB85101 100 μg

Anti-ALDH1A1 Polyclonal Antibody

Sign In for Pricing
View Details
MPPED2 Antibody, HRP conjugated
CSB-PA618997LB01HU-01 50 µg

MPPED2 Antibody, HRP conjugated

Sign In for Pricing
View Details
MPPED2 Antibody, HRP conjugated
CSB-PA618997LB01HU-02 100 µg

MPPED2 Antibody, HRP conjugated

Sign In for Pricing
View Details
P4HTM Polyclonal Antibody
MBS8572771-01 0.1 mL

P4HTM Polyclonal Antibody

Sign In for Pricing
View Details
P4HTM Polyclonal Antibody
MBS8572771-02 0.1 mL (AF405L)

P4HTM Polyclonal Antibody

Sign In for Pricing
View Details