Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Puccinia triticina TNFR-Cys domain-containing protein (PTTG_11707)

Product Specifications

Abbreviation

Recombinant Puccinia triticina PTTG_11707 protein

Gene Name

PTTG_11707

UniProt

A0A180H5P9

Expression Region

32-121aa

Organism

Puccinia triticina (isolate 1-1 / race 1 (BBBD) ) (Brown leaf rust fungus)

Target Sequence

IEVIQCGKCNLSVTGESSTMPCPKLKKCGIHTCGNMNRSATAWRCTCGWYKSKPTGTCNQCGAECACKVSTDSYTKKLSRQASSSHWDWE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.8 kDa

References & Citations

"Comparative analysis highlights variable genome content of wheat rusts and divergence of the mating loci." Cuomo C.A., Bakkeren G., Szabo L., Khalil H., Joly D., Goldberg J., Young S., Zeng Q., Fellers J. Submitted (MAY-2016)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-100 1x 100 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-100 1x 100 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF594 conjugate, 0.1mg/mL
BNC942276-500 1x 500 µL

CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details