Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMD Peptide - middle region

OMD Peptide - middle region

Product Specifications

Product Name Alternative

OSAD, SLRR2C

UniProt

Q99983

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OMD Rabbit Polyclonal Antibody (orb589354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 14 (PE)
C9097-14C-PE 100 µL

Cytokeratin 14 (PE)

Sign In for Pricing
View Details
Rat Tmem276 Pre-designed siRNA Set B
SI214826B 1 Each

Rat Tmem276 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-POP7 Rabbit pAb
GB113242-50 50 μL

Anti-POP7 Rabbit pAb

Sign In for Pricing
View Details
RRM1, NT (RRM1, RR1, Ribonucleoside-diphosphate reductase large subunit, Ribonucleoside-diphosphate reductase subunit M1, Ribonucleotide reductase large subunit) (MaxLight 490) discontinued
041281-ML490 100 µL

RRM1, NT (RRM1, RR1, Ribonucleoside-diphosphate reductase large subunit, Ribonucleoside-diphosphate reductase subunit M1, Ribonucleotide reductase large subunit) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Phospho-CDH5 (Y731) Antibody
MBS7118846-01 0.05 mg

Phospho-CDH5 (Y731) Antibody

Sign In for Pricing
View Details
Phospho-CDH5 (Y731) Antibody
MBS7118846-02 0.1 mg

Phospho-CDH5 (Y731) Antibody

Sign In for Pricing
View Details