Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMD Peptide - middle region

OMD Peptide - middle region

Product Specifications

Product Name Alternative

OSAD, SLRR2C

UniProt

Q99983

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OMD Rabbit Polyclonal Antibody (orb589354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANBP17 Antibody
MBS9411743-01 0.05 mL

RANBP17 Antibody

Sign In for Pricing
View Details
RANBP17 Antibody
MBS9411743-02 0.1 mL

RANBP17 Antibody

Sign In for Pricing
View Details
RANBP17 Antibody
MBS9411743-03 5x 0.1 mL

RANBP17 Antibody

Sign In for Pricing
View Details
CD33 Antibody
CSB-PA004925ESR2HU-01 50 μL

CD33 Antibody

Sign In for Pricing
View Details
CD33 Antibody
CSB-PA004925ESR2HU-02 100 µL

CD33 Antibody

Sign In for Pricing
View Details
Recombinant Pig Protein delta homolog 2 (DLK2)
orb2902550-01 20 µg

Recombinant Pig Protein delta homolog 2 (DLK2)

Sign In for Pricing
View Details