Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR48 Peptide - C-terminal region

WDR48 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P80, UAF1, SPG60

UniProt

Q8TAF3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065890

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WDR12 Antibody Picoband® Fluoro647 Conjugated
A07492-1-Fluoro647 100 µg/Vial

Anti-WDR12 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
MOX-2 Rabbit Polyclonal Antibody
APRab14051-01 20 µL

MOX-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOX-2 Rabbit Polyclonal Antibody
APRab14051-02 50 µL

MOX-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOX-2 Rabbit Polyclonal Antibody
APRab14051-03 100 µL

MOX-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOX-2 Rabbit Polyclonal Antibody
APRab14051-04 200 µL

MOX-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dog Immunoglobulin G, IgG ELISA Kit
MBS707121-01 24 Well (LIMIT 1)

Dog Immunoglobulin G, IgG ELISA Kit

Sign In for Pricing
View Details