Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS17 Peptide - N-terminal region

RPS17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S17, DBA4, RPS17L, RPS17L1, RPS17L2

UniProt

P08708

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS17 Rabbit Polyclonal Antibody (orb588884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001012.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKIAGYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Trypsin (TRY)
MBS2148572-01 0.1 mL

PE-Linked Polyclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trypsin (TRY)
MBS2148572-02 0.2 mL

PE-Linked Polyclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trypsin (TRY)
MBS2148572-03 0.5 mL

PE-Linked Polyclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trypsin (TRY)
MBS2148572-04 1 mL

PE-Linked Polyclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trypsin (TRY)
MBS2148572-05 5 mL

PE-Linked Polyclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Trypsin (TRY)
MBS2148572-06 5x 5 mL

PE-Linked Polyclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details